PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016456681.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 304aa    MW: 34345 Da    PI: 10.137
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016456681.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.61.1e-151454242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +ien+ nrqvtfsk rn ++KKA+EL ++++aev +i+  +
  XP_016456681.1 14 KIENQNNRQVTFSKHRNCVFKKANELDIMTGAEVGIIVCPQ 54
                    79***********************************9755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-17564IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.395565IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.06E-20675IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-13727IPR002100Transcription factor, MADS-box
PfamPF003198.6E-181461IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-132742IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-134263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSTRQGRKSV RIAKIENQNN RQVTFSKHRN CVFKKANELD IMTGAEVGII VCPQGSKPYS  60
FGHPNVNETI NKYVGEERPP SPSSPGIDDK YVQMFRKDNS RKLNTRLNSL QNQLDSALNL  120
KSKLKQMNKN VESQQEWFKG PIEKMNYTEA SMLKEGLEDL LLKVKNYGTE RAYALAAEAA  180
AQKHEVRRRS RKREGAASSQ KRTLVRRSEL ARRSDHNLRK SEVADATSHM RDLACKYKPR  240
ICEETIAFAS SGLRGRPSQL QSFDRICDPG SPHLLTLRCD VSCICGLRNC EDQVANATSA  300
AEQL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0079031e-42AJ007903.1 Nicotiana tabacum DNA adjacent to H9NP T-DNA left border.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016456681.10.0PREDICTED: agamous-like MADS-box protein AGL29
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA3829435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-22AGAMOUS-like 61